PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18730A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 258aa    MW: 27036.5 Da    PI: 6.1554
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18730AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.38.4e-41631621100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lq
  Oropetium_20150105_18730A  63 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEVERADAASSLVYEANLRLRDPVYGCMGAISVLQ 146
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq++ l+ael+++++e
  Oropetium_20150105_18730A 147 QQVNALEAELDAVRAE 162
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.29362163IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4063160IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSTESSACWS LTRERLDEIG KKIKREPDAT GIAAATASAS TALVENPVPR SLGLGGALNT  60
VTPCAACKLL RRRCAQECPF APYFSPHEPH KFAAVHKVFG ASNVSKMLLE VPEVERADAA  120
SSLVYEANLR LRDPVYGCMG AISVLQQQVN ALEAELDAVR AEIFKHRYRQ AGAGAGLTDD  180
DVQATARFVA PHPPLLAGDV VSVAEAGQDI ANPAGVPAGM SAAAASAVYI AKAVEQPSST  240
TDHYSSLNTS EHASYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-132AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-116PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T57e-70LBD15_ARATH; LOB domain-containing protein 15
TrEMBLK3XRN11e-117K3XRN1_SETIT; Uncharacterized protein
STRINGSi004575m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-69LOB domain-containing protein 15